General Information

  • ID:  hor000074
  • Uniprot ID:  P10769
  • Protein name:  Neurophysin 2
  • Gene name:  AVP
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ALSDTELRQCLPCGPGGQGRCFGPSICCADALGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAANGVCCNDESCVIEPECREEFHRPV
  • Length:  93
  • Propeptide:  CYFQNCPRGGKRALSDTELRQCLPCGPGGQGRCFGPSICCADALGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAANGVCCNDESCVIEPECREEFHRPVRAGDRSNVTQLDGPAGALLLRLMQLAGAPEPQPAAPGGY
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Specifically binds the midbrain peptide hormone vasopressin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AVPR2, AVPR1A
  • Target Unid:  H0VM08, A0A286XZX0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  AF-P10769-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000074_AF2.pdbhor000074_ESM.pdb

Physical Information

Mass: 1138618 Formula: C399H630N122O135S14
Absent amino acids: MW Common amino acids: C
pI: 4.38 Basic residues: 8
Polar residues: 38 Hydrophobic residues: 22
Hydrophobicity: -26.45 Boman Index: -15415
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.55
Instability Index: 6036.67 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.71

Literature

  • PubMed ID:  3803579
  • Title:  Guinea Pig Neurohypophysial Hormones. Peculiar Processing of the Three-Domain Vasopressin Precursor